SCOPe 2.03: Domain d3mmza_: 3mmz A:

Lineage for d3mmza_ (3mmz A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (43 species)
   not a true protein

7. Species Streptomyces avermitilis [TaxId:227882] [232929] (1 PDB entry)

8. Domain d3mmza_: 3mmz A: [232930]
   automated match to d3e81a_
   complexed with ca, cl

Details for d3mmza_

PDB Entry: 3mmz, 1.84 Å

PDB Description: crystal structure of putative had family hydrolase from streptomyces avermitilis ma-4680

PDB Compounds: (A:) putative HAD family hydrolase

SCOPe Domain Sequences for d3mmza_:

Sequence; same for both SEQRES and ATOM records:

>d3mmza_ c.108.1.0 (A:) automated matches {Streptomyces avermitilis [TaxId: 227882]}
slgalptaedidavvldfdgtqtddrvlidsdgrefvsvhrgdglgiaalrksgltmlil
steqnpvvaararklkipvlhgidrkdlalkqwceeqgiapervlyvgndvndlpcfalv
gwpvavasahdvvrgaaravttvpggdgaireiaswilgpsld

Timeline for d3mmza_:

• d3mmza_ is new in SCOPe 2.03-stable
  
• d3mmza_ appears in SCOPe 2.04
  
• d3mmza_ appears in the current release, SCOPe 2.08, called d3mmza1