SCOPe 2.02: Domain d1f2nc_: 1f2n C:

Lineage for d1f2nc_ (1f2n C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)

6. Protein Sobemovirus coat protein [88644] (4 species)

7. Species RYMV (Rice yellow mottle virus) [TaxId:31744] [49626] (1 PDB entry)

8. Domain d1f2nc_: 1f2n C: [23293]
   complexed with ca

Details for d1f2nc_

PDB Entry: 1f2n, 2.8 Å

PDB Description: rice yellow mottle virus

PDB Compounds: (C:) capsid protein

SCOPe Domain Sequences for d1f2nc_:

Sequence; same for both SEQRES and ATOM records:

>d1f2nc_ b.121.4.7 (C:) Sobemovirus coat protein {RYMV (Rice yellow mottle virus) [TaxId: 31744]}
aepqlqrapvaqasrisgtvpgplssntwplhsvefladfkrsstsadattydcvpfnlp
rvwslarcysmwkptrwdvvylpevsatvagsiemcflydyadtiprytgkmsrtagfvt
ssvwygaegchllsggsarnavvasmdcsrvgwkrvtssipssvdpnvvntilparlavr
ssikptvsdtpgklyviasmvlrdpvdptlnt

Timeline for d1f2nc_:

• d1f2nc_ first appeared (with stable ids) in SCOP 1.55
  
• d1f2nc_ appears in SCOPe 2.01
  
• d1f2nc_ appears in SCOPe 2.03
  
• d1f2nc_ appears in the current release, SCOPe 2.08