| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.14: Fumble-like [159623] (6 proteins) Pfam PF03630; type II pantothenate kinase-like |
| Protein Pantothenate kinase 3, PANK3, C-terminal domain [419001] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [419473] (3 PDB entries) Uniprot Q9H999 |
| Domain d3mk6a2: 3mk6 A:157-368 [232928] Other proteins in same PDB: d3mk6a1, d3mk6a3, d3mk6b1, d3mk6b3, d3mk6c1, d3mk6c3, d3mk6d1, d3mk6d3 automated match to d2i7na2 complexed with aco, gol has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3mk6 (more details), 1.98 Å
SCOPe Domain Sequences for d3mk6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mk6a2 c.55.1.14 (A:157-368) Pantothenate kinase 3, PANK3, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qaecyyfanasepercqkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslggg
tflglcslltgcesfeealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmi
ykekresvskedlaratlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllay
aldywskgqlkalflehegyfgavgallglpn
Timeline for d3mk6a2: