Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.14: Fumble-like [159623] (6 proteins) Pfam PF03630; type II pantothenate kinase-like |
Protein Pantothenate kinase 3, PANK3, N-terminal domain [419000] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [419472] (3 PDB entries) Uniprot Q9H999 |
Domain d3mk6a1: 3mk6 A:12-156 [232927] Other proteins in same PDB: d3mk6a2, d3mk6a3, d3mk6b2, d3mk6b3, d3mk6c2, d3mk6c3, d3mk6d2, d3mk6d3 automated match to d2i7na1 complexed with aco, gol |
PDB Entry: 3mk6 (more details), 1.98 Å
SCOPe Domain Sequences for d3mk6a1:
Sequence, based on SEQRES records: (download)
>d3mk6a1 c.55.1.14 (A:12-156) Pantothenate kinase 3, PANK3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} pwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdvhlelk dltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfrtignl hlhkldeldclvkgllyidsvsfng
>d3mk6a1 c.55.1.14 (A:12-156) Pantothenate kinase 3, PANK3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} pwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnirdvhlelkdltlfgr rgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfignlhlhkldeld clvkgllyidsvsfng
Timeline for d3mk6a1: