Lineage for d3mgxa_ (3mgx A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005535Species Amycolatopsis balhimycina [TaxId:208443] [232919] (1 PDB entry)
  8. 2005536Domain d3mgxa_: 3mgx A: [232920]
    automated match to d2xkra_
    complexed with gol, hem

Details for d3mgxa_

PDB Entry: 3mgx (more details), 2.1 Å

PDB Description: Crystal Structure of P450 OxyD that is involved in the Biosynthesis of Vancomycin-type Antibiotics
PDB Compounds: (A:) Putative P450 monooxygenase

SCOPe Domain Sequences for d3mgxa_:

Sequence, based on SEQRES records: (download)

>d3mgxa_ a.104.1.0 (A:) automated matches {Amycolatopsis balhimycina [TaxId: 208443]}
avdlgnpdlyttlerharwrelaaedamvwsdpgsspsgfwsvfshracaavlapsaplt
seygmmigfdrdhpdnsggrmmvvseheqhrklrklvgpllsraaarklaervrievgdv
lgrvldgevcdaataigpripaavvceilgvpaededmlidltnhafggedelfdgmtpr
qahteilvyfdelitarrkepgddlvstlvtdddltiddvllncdnvliggnettrhait
gavhalatvpglltalrdgsadvdtvveevlrwtspamhvlrvttadvtingrdlpsgtp
vvawlpaanrdpaefddpdtflpgrkpnrhitfghgmhhclgsalarielsvvlrvlaer
vsrvdlerepawlraivvqgyrelpvrftgr

Sequence, based on observed residues (ATOM records): (download)

>d3mgxa_ a.104.1.0 (A:) automated matches {Amycolatopsis balhimycina [TaxId: 208443]}
avdlgnpdlyttlerharwrelaaedamvwsdpgsspsgfwsvfshracaavlapsaplt
seygmmigfdrdhpdnsggrmmvvseheqhrklrklvgpllsraaarklaervrievgdv
lgrvldgevcdaataigpripaavvceilgvpaededmlidltnhafggedgmtprqaht
eilvyfdelitarrkepgddlvstlvtdddltiddvllncdnvliggnettrhaitgavh
alatvpglltalrdgsadvdtvveevlrwtspamhvlrvttadvtingrdlpsgtpvvaw
lpaanrdpaefddpdtflpgrkpnrhitfghgmhhclgsalarielsvvlrvlaervsrv
dlerepawlraivvqgyrelpvrftgr

SCOPe Domain Coordinates for d3mgxa_:

Click to download the PDB-style file with coordinates for d3mgxa_.
(The format of our PDB-style files is described here.)

Timeline for d3mgxa_: