SCOPe 2.06: Domain d3mgea2: 3mge A:148-219

Lineage for d3mgea2 (3mge A:148-219)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (10 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11698] [232917] (4 PDB entries)

8. Domain d3mgea2: 3mge A:148-219 [232918]
   Other proteins in same PDB: d3mgea1
   automated match to d1e6jp1
   complexed with edo

Details for d3mgea2

PDB Entry: 3mge, 1.9 Å

PDB Description: x-ray structure of hexameric hiv-1 ca

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d3mgea2:

Sequence, based on SEQRES records:

>d3mgea2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records):

>d3mgea2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqtetllvqnanpdcktilkalgpgatleemmt
acq

Timeline for d3mgea2:

• d3mgea2 first appeared in SCOPe 2.03
  
• d3mgea2 appears in SCOPe 2.05
  
• d3mgea2 appears in SCOPe 2.07
  
• d3mgea2 appears in the current release, SCOPe 2.08