| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
| Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
| Protein automated matches [191156] (12 species) not a true protein |
| Species Human immunodeficiency virus type 1 [TaxId:11698] [232917] (4 PDB entries) |
| Domain d3mgea2: 3mge A:148-219 [232918] Other proteins in same PDB: d3mgea1 automated match to d1e6jp1 complexed with edo |
PDB Entry: 3mge (more details), 1.9 Å
SCOPe Domain Sequences for d3mgea2:
Sequence, based on SEQRES records: (download)
>d3mgea2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq
>d3mgea2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqtetllvqnanpdcktilkalgpgatleemmt
acq
Timeline for d3mgea2: