Lineage for d3mgea2 (3mge A:148-219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706683Species Human immunodeficiency virus type 1 [TaxId:11698] [232917] (4 PDB entries)
  8. 2706684Domain d3mgea2: 3mge A:148-219 [232918]
    Other proteins in same PDB: d3mgea1
    automated match to d1e6jp1
    complexed with edo

Details for d3mgea2

PDB Entry: 3mge (more details), 1.9 Å

PDB Description: x-ray structure of hexameric hiv-1 ca
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d3mgea2:

Sequence, based on SEQRES records: (download)

>d3mgea2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records): (download)

>d3mgea2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqtetllvqnanpdcktilkalgpgatleemmt
acq

SCOPe Domain Coordinates for d3mgea2:

Click to download the PDB-style file with coordinates for d3mgea2.
(The format of our PDB-style files is described here.)

Timeline for d3mgea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mgea1