Lineage for d3mgea1 (3mge A:1-147)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495228Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1495229Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1495230Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1495354Protein automated matches [190369] (6 species)
    not a true protein
  7. 1495384Species Human immunodeficiency virus type 1 [TaxId:11698] [232915] (1 PDB entry)
  8. 1495385Domain d3mgea1: 3mge A:1-147 [232916]
    Other proteins in same PDB: d3mgea2
    automated match to d1e6jp2
    complexed with edo

Details for d3mgea1

PDB Entry: 3mge (more details), 1.9 Å

PDB Description: x-ray structure of hexameric hiv-1 ca
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d3mgea1:

Sequence, based on SEQRES records: (download)

>d3mgea1 a.73.1.1 (A:1-147) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsclsegatpqdlncmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d3mgea1 a.73.1.1 (A:1-147) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
pivmvhqaisprtlnawvkvveekafspevipmfsclsegatpqdlncmlntvgghqaam
qmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipv
geiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d3mgea1:

Click to download the PDB-style file with coordinates for d3mgea1.
(The format of our PDB-style files is described here.)

Timeline for d3mgea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mgea2