![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
![]() | Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
![]() | Protein automated matches [190369] (8 species) not a true protein |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11698] [232915] (1 PDB entry) |
![]() | Domain d3mgea1: 3mge A:1-147 [232916] Other proteins in same PDB: d3mgea2 automated match to d1e6jp2 complexed with edo |
PDB Entry: 3mge (more details), 1.9 Å
SCOPe Domain Sequences for d3mgea1:
Sequence, based on SEQRES records: (download)
>d3mgea1 a.73.1.1 (A:1-147) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]} pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsclsegatpqdlncmlntvg ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth nppipvgeiykrwiilglnkivrmysp
>d3mgea1 a.73.1.1 (A:1-147) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]} pivmvhqaisprtlnawvkvveekafspevipmfsclsegatpqdlncmlntvgghqaam qmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipv geiykrwiilglnkivrmysp
Timeline for d3mgea1: