Lineage for d3mg9a1 (3mg9 A:0-285)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114841Species Uncultured soil [TaxId:164851] [232913] (3 PDB entries)
  8. 2114843Domain d3mg9a1: 3mg9 A:0-285 [232914]
    Other proteins in same PDB: d3mg9a2
    automated match to d2reoa_
    complexed with fmt, gol

Details for d3mg9a1

PDB Entry: 3mg9 (more details), 2.27 Å

PDB Description: Teg 12 Binary Structure Complexed with the Teicoplanin Aglycone
PDB Compounds: (A:) Teg12

SCOPe Domain Sequences for d3mg9a1:

Sequence, based on SEQRES records: (download)

>d3mg9a1 c.37.1.0 (A:0-285) automated matches {Uncultured soil [TaxId: 164851]}
smngirwiasypkagntwvrcmlaayitgkapqvwndidaesltleamlrfgdlppaepm
epvlvkthlkadvpvlglygeatakvlylvrnprdmllssmrmasisrddveksrdfark
fianeglgwnalgagggvglgswpenvrswtesssdrfpnadvltmryedlkgdpvarfs
eivefldlggpvdiedirravaastlermrelekrseqqgggspirhgdarmmkggpgga
rpqfvgegrydqslsflgediesdyqellhgdsgfalyakqygyag

Sequence, based on observed residues (ATOM records): (download)

>d3mg9a1 c.37.1.0 (A:0-285) automated matches {Uncultured soil [TaxId: 164851]}
smngirwiasypkagntwvrcmlaayitgkapqvwndidaesltleamlrfgdlppaepm
epvlvkthlkadvpvlglygeatakvlylvrnprdmllssmrmasisrddveksrdfark
fianeglgwnggvglgswpenvrswtesssdrfpnadvltmryedlkgdpvarfseivef
ldlggpvdiedirravaastlermrelekrsegrydqslsflgediesdyqellhgdsgf
alyakqygyag

SCOPe Domain Coordinates for d3mg9a1:

Click to download the PDB-style file with coordinates for d3mg9a1.
(The format of our PDB-style files is described here.)

Timeline for d3mg9a1: