SCOPe 2.07: Domain d3mfha2: 3mfh A:390-512

Lineage for d3mfha2 (3mfh A:390-512)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.0: automated matches [231323] (1 protein)
   not a true family

6. Protein automated matches [231324] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231491] (7 PDB entries)

8. Domain d3mfha2: 3mfh A:390-512 [232912]
   Other proteins in same PDB: d3mfha1
   automated match to d1jiha1
   protein/DNA complex; complexed with dtp, mg, so4

Details for d3mfha2

PDB Entry: 3mfh, 2 Å

PDB Description: dna polymerase eta in complex with undamaged dna

PDB Compounds: (A:) DNA Polymerase ETA

SCOPe Domain Sequences for d3mfha2:

Sequence; same for both SEQRES and ATOM records:

>d3mfha2 d.240.1.0 (A:390-512) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt
ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii
dlq

Timeline for d3mfha2:

• d3mfha2 first appeared in SCOPe 2.03
  
• d3mfha2 appears in SCOPe 2.06
  
• d3mfha2 appears in the current release, SCOPe 2.08