SCOPe 2.06: Domain d3mcyb_: 3mcy B:

Lineage for d3mcyb_ (3mcy B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (2 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (23 PDB entries)

8. Domain d3mcyb_: 3mcy B: [232910]
   automated match to d4av5a_
   complexed with ca, cl, gol, zh1

Details for d3mcyb_

PDB Entry: 3mcy, 2.9 Å

PDB Description: Crystal structure of FimH lectin domain bound to biphenyl mannoside meta-methyl ester.

PDB Compounds: (B:) FimH

SCOPe Domain Sequences for d3mcyb_:

Sequence; same for both SEQRES and ATOM records:

>d3mcyb_ b.2.3.2 (B:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d3mcyb_:

• d3mcyb_ first appeared in SCOPe 2.03
  
• d3mcyb_ appears in SCOPe 2.05
  
• d3mcyb_ appears in SCOPe 2.07
  
• d3mcyb_ appears in the current release, SCOPe 2.08