Class b: All beta proteins [48724] (174 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins) |
Protein Sobemovirus coat protein [88644] (4 species) |
Species RYMV (Rice yellow mottle virus) [TaxId:31744] [49626] (1 PDB entry) |
Domain d1f2na_: 1f2n A: [23291] complexed with ca |
PDB Entry: 1f2n (more details), 2.8 Å
SCOPe Domain Sequences for d1f2na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f2na_ b.121.4.7 (A:) Sobemovirus coat protein {RYMV (Rice yellow mottle virus) [TaxId: 31744]} lssntwplhsvefladfkrsstsadattydcvpfnlprvwslarcysmwkptrwdvvylp evsatvagsiemcflydyadtiprytgkmsrtagfvtssvwygaegchllsggsarnavv asmdcsrvgwkrvtssipssvdpnvvntilparlavrssikptvsdtpgklyviasmvlr dpvdptlnt
Timeline for d1f2na_: