Class b: All beta proteins [48724] (93 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.2: Plant virus proteins [49616] (15 proteins) |
Protein RYMV capsid protein [49625] (1 species) |
Species Rice yellow mottle virus [TaxId:31744] [49626] (1 PDB entry) |
Domain d1f2na_: 1f2n A: [23291] |
PDB Entry: 1f2n (more details), 2.8 Å
SCOP Domain Sequences for d1f2na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f2na_ b.10.1.2 (A:) RYMV capsid protein {Rice yellow mottle virus} lssntwplhsvefladfkrsstsadattydcvpfnlprvwslarcysmwkptrwdvvylp evsatvagsiemcflydyadtiprytgkmsrtagfvtssvwygaegchllsggsarnavv asmdcsrvgwkrvtssipssvdpnvvntilparlavrssikptvsdtpgklyviasmvlr dpvdptlnt
Timeline for d1f2na_: