Lineage for d1f2na_ (1f2n A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11461Family b.10.1.2: Plant virus proteins [49616] (15 proteins)
  6. 11486Protein RYMV capsid protein [49625] (1 species)
  7. 11487Species Rice yellow mottle virus [TaxId:31744] [49626] (1 PDB entry)
  8. 11488Domain d1f2na_: 1f2n A: [23291]

Details for d1f2na_

PDB Entry: 1f2n (more details), 2.8 Å

PDB Description: rice yellow mottle virus

SCOP Domain Sequences for d1f2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2na_ b.10.1.2 (A:) RYMV capsid protein {Rice yellow mottle virus}
lssntwplhsvefladfkrsstsadattydcvpfnlprvwslarcysmwkptrwdvvylp
evsatvagsiemcflydyadtiprytgkmsrtagfvtssvwygaegchllsggsarnavv
asmdcsrvgwkrvtssipssvdpnvvntilparlavrssikptvsdtpgklyviasmvlr
dpvdptlnt

SCOP Domain Coordinates for d1f2na_:

Click to download the PDB-style file with coordinates for d1f2na_.
(The format of our PDB-style files is described here.)

Timeline for d1f2na_: