Lineage for d1f2na_ (1f2n A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822375Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)
  6. 2822386Protein Sobemovirus coat protein [88644] (4 species)
  7. 2822391Species RYMV (Rice yellow mottle virus) [TaxId:31744] [49626] (1 PDB entry)
  8. 2822392Domain d1f2na_: 1f2n A: [23291]
    complexed with ca

Details for d1f2na_

PDB Entry: 1f2n (more details), 2.8 Å

PDB Description: rice yellow mottle virus
PDB Compounds: (A:) capsid protein

SCOPe Domain Sequences for d1f2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2na_ b.121.4.7 (A:) Sobemovirus coat protein {RYMV (Rice yellow mottle virus) [TaxId: 31744]}
lssntwplhsvefladfkrsstsadattydcvpfnlprvwslarcysmwkptrwdvvylp
evsatvagsiemcflydyadtiprytgkmsrtagfvtssvwygaegchllsggsarnavv
asmdcsrvgwkrvtssipssvdpnvvntilparlavrssikptvsdtpgklyviasmvlr
dpvdptlnt

SCOPe Domain Coordinates for d1f2na_:

Click to download the PDB-style file with coordinates for d1f2na_.
(The format of our PDB-style files is described here.)

Timeline for d1f2na_: