Lineage for d3m8pa2 (3m8p A:430-555)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495252Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries)
  8. 2495257Domain d3m8pa2: 3m8p A:430-555 [232904]
    Other proteins in same PDB: d3m8pa1, d3m8pb_
    automated match to d3di6a3
    complexed with 65b

Details for d3m8pa2

PDB Entry: 3m8p (more details), 2.67 Å

PDB Description: hiv-1 rt with nnrti tmc-125
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3m8pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m8pa2 c.55.3.0 (A:430-555) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsag

SCOPe Domain Coordinates for d3m8pa2:

Click to download the PDB-style file with coordinates for d3m8pa2.
(The format of our PDB-style files is described here.)

Timeline for d3m8pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3m8pa1
View in 3D
Domains from other chains:
(mouse over for more information)
d3m8pb_