| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) ![]() |
| Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins) |
| Protein automated matches [232896] (1 species) not a true protein |
| Species Archaeoglobus fulgidus [TaxId:2234] [232897] (2 PDB entries) |
| Domain d3m7nf2: 3m7n F:154-253 [232902] Other proteins in same PDB: d3m7nd1, d3m7ne1, d3m7nf1, d3m7ng1, d3m7ng2, d3m7nh1, d3m7nh2, d3m7ni1, d3m7ni2 automated match to d2ba1d2 protein/RNA complex; complexed with zn |
PDB Entry: 3m7n (more details), 2.4 Å
SCOPe Domain Sequences for d3m7nf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m7nf2 d.101.1.1 (F:154-253) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
pmkgmitsvavgkadgqlvldpmkeednfgeadmpfaflirngkiesiallqmdgrmtrd
evkqaielakkgalqiyemqreailrryievgeemdeite
Timeline for d3m7nf2: