Lineage for d1smvc_ (1smv C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11461Family b.10.1.2: Plant virus proteins [49616] (15 proteins)
  6. 11496Protein SMV coat potein [49623] (1 species)
  7. 11497Species Sesbania mosaic virus [TaxId:12558] [49624] (1 PDB entry)
  8. 11500Domain d1smvc_: 1smv C: [23290]

Details for d1smvc_

PDB Entry: 1smv (more details), 3 Å

PDB Description: primary structure of sesbania mosaic virus coat protein: its implications to the assembly and architecture of the virus

SCOP Domain Sequences for d1smvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smvc_ b.10.1.2 (C:) SMV coat potein {Sesbania mosaic virus}
qagismapsaqgamvrirnpavsssrgaitvlhceltaeigvtdsivvsselvmpytvgt
wlrgvadnwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnklsnlrgyvs
gqvwsgsaglcfinnsrcsdtstaisttldvselgkkwypyktsadyatavgvdvniatd
lvparlvialldgssstavaagriydtytiqmieptasalnl

SCOP Domain Coordinates for d1smvc_:

Click to download the PDB-style file with coordinates for d1smvc_.
(The format of our PDB-style files is described here.)

Timeline for d1smvc_: