Lineage for d3m7nd2 (3m7n D:154-250)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663434Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1663435Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1663436Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 1663579Protein automated matches [232896] (1 species)
    not a true protein
  7. 1663580Species Archaeoglobus fulgidus [TaxId:2234] [232897] (2 PDB entries)
  8. 1663581Domain d3m7nd2: 3m7n D:154-250 [232898]
    Other proteins in same PDB: d3m7nd1, d3m7ne1, d3m7nf1, d3m7ng1, d3m7ng2, d3m7nh1, d3m7nh2, d3m7ni1, d3m7ni2
    automated match to d2ba1d2
    protein/RNA complex; complexed with zn

Details for d3m7nd2

PDB Entry: 3m7n (more details), 2.4 Å

PDB Description: archaeoglobus fulgidus exosome with RNA bound to the active site
PDB Compounds: (D:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d3m7nd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m7nd2 d.101.1.1 (D:154-250) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
pmkgmitsvavgkadgqlvldpmkeednfgeadmpfaflirngkiesiallqmdgrmtrd
evkqaielakkgalqiyemqreailrryievgeemde

SCOPe Domain Coordinates for d3m7nd2:

Click to download the PDB-style file with coordinates for d3m7nd2.
(The format of our PDB-style files is described here.)

Timeline for d3m7nd2: