Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (10 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (3 PDB entries) |
Domain d3m63b_: 3m63 B: [232888] automated match to d3v6eb_ complexed with 1pe, k |
PDB Entry: 3m63 (more details), 2.4 Å
SCOPe Domain Sequences for d3m63b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m63b_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyhi qdghsvhlvksq
Timeline for d3m63b_: