Lineage for d3m63b_ (3m63 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933106Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (8 PDB entries)
  8. 2933116Domain d3m63b_: 3m63 B: [232888]
    automated match to d3v6eb_
    complexed with 1pe, k

Details for d3m63b_

PDB Entry: 3m63 (more details), 2.4 Å

PDB Description: crystal structure of ufd2 in complex with the ubiquitin-like (ubl) domain of dsk2
PDB Compounds: (B:) Ubiquitin domain-containing protein DSK2

SCOPe Domain Sequences for d3m63b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m63b_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyhi
qdghsvhlvksq

SCOPe Domain Coordinates for d3m63b_:

Click to download the PDB-style file with coordinates for d3m63b_.
(The format of our PDB-style files is described here.)

Timeline for d3m63b_: