SCOPe 2.06: Domain d3m5la1: 3m5l A:986-1179

Lineage for d3m5la1 (3m5l A:986-1179)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein NS3 protease [50600] (5 species)

7. Species Hepatitis c virus subtype 1a [TaxId:31646] [254867] (2 PDB entries)

8. Domain d3m5la1: 3m5l A:986-1179 [232887]
   Other proteins in same PDB: d3m5la2
   automated match to d3sv8a_
   complexed with so4, tsv, zn

Details for d3m5la1

PDB Entry: 3m5l, 1.25 Å

PDB Description: crystal structure of hcv ns3/4a protease in complex with itmn-191

PDB Compounds: (A:) ns3/4a

SCOPe Domain Sequences for d3m5la1:

Sequence; same for both SEQRES and ATOM records:

>d3m5la1 b.47.1.3 (A:986-1179) NS3 protease {Hepatitis c virus subtype 1a [TaxId: 31646]}
mkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtfla
tsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdly
lvtrhadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavstrgvak
avdfipveslettm

Timeline for d3m5la1:

• d3m5la1 first appeared in SCOPe 2.03, called d3m5la_
  
• d3m5la1 was called d3m5la_ in SCOPe 2.05
  
• d3m5la1 appears in SCOPe 2.07
  
• d3m5la1 appears in the current release, SCOPe 2.08