SCOPe 2.03: Domain d3m5ca1: 3m5c A:3-164

Lineage for d3m5ca1 (3m5c A:3-164)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (20 species)
   not a true protein

7. Species Xanthomonas campestris [TaxId:340] [232879] (3 PDB entries)

8. Domain d3m5ca1: 3m5c A:3-164 [232882]
   automated match to d2w37a1
   complexed with pa9, so4; mutant

Details for d3m5ca1

PDB Entry: 3m5c, 1.85 Å

PDB Description: crystal structure of n-acetyl-l-ornithine transcarbamylase k302e mutant complexed with palao

PDB Compounds: (A:) N-acetylornithine carbamoyltransferase

SCOPe Domain Sequences for d3m5ca1:

Sequence; same for both SEQRES and ATOM records:

>d3m5ca1 c.78.1.0 (A:3-164) automated matches {Xanthomonas campestris [TaxId: 340]}
lkhflntqdwsraeldalltqaalfkrnklgselkgksialvffnpsmrtrtsfelgafq
lgghavvlqpgkdawpiefnlgtvmdgdteehiaevarvlgryvdligvrafpkfvdwsk
dredqvlksfakyspvpvinmetithpcqelahalalqehfg

Timeline for d3m5ca1:

• d3m5ca1 is new in SCOPe 2.03-stable
  
• d3m5ca1 appears in SCOPe 2.04
  
• d3m5ca1 appears in the current release, SCOPe 2.08