Lineage for d3m5da1 (3m5d A:3-164)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907321Species Xanthomonas campestris [TaxId:340] [232879] (3 PDB entries)
  8. 2907326Domain d3m5da1: 3m5d A:3-164 [232881]
    automated match to d2w37a1
    complexed with pa9, so4; mutant

Details for d3m5da1

PDB Entry: 3m5d (more details), 2.2 Å

PDB Description: crystal structure of n-acetyl-l-ornithine transcarbamylase k302r mutant complexed with palao
PDB Compounds: (A:) N-acetylornithine carbamoyltransferase

SCOPe Domain Sequences for d3m5da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5da1 c.78.1.0 (A:3-164) automated matches {Xanthomonas campestris [TaxId: 340]}
lkhflntqdwsraeldalltqaalfkrnklgselkgksialvffnpsmrtrtsfelgafq
lgghavvlqpgkdawpiefnlgtvmdgdteehiaevarvlgryvdligvrafpkfvdwsk
dredqvlksfakyspvpvinmetithpcqelahalalqehfg

SCOPe Domain Coordinates for d3m5da1:

Click to download the PDB-style file with coordinates for d3m5da1.
(The format of our PDB-style files is described here.)

Timeline for d3m5da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3m5da2