![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
![]() | Protein automated matches [226938] (26 species) not a true protein |
![]() | Species Xanthomonas campestris [TaxId:340] [232879] (3 PDB entries) |
![]() | Domain d3m4na1: 3m4n A:3-164 [232880] automated match to d2w37a1 complexed with pa9, so4; mutant |
PDB Entry: 3m4n (more details), 1.9 Å
SCOPe Domain Sequences for d3m4na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m4na1 c.78.1.0 (A:3-164) automated matches {Xanthomonas campestris [TaxId: 340]} lkhflntqdwsraeldalltqaalfkrnklgselkgksialvffnpsmrtrtsfelgafq lgghavvlqpgkdawpiefnlgtvmdgdteehiaevarvlgryvdligvrafpkfvdwsk dredqvlksfakyspvpvinmetithpcqelahalalqehfg
Timeline for d3m4na1: