Class b: All beta proteins [48724] (176 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins) |
Protein Sobemovirus coat protein [88644] (4 species) |
Species SMV (Sesbania mosaic virus) [TaxId:12558] [49624] (5 PDB entries) Uniprot Q9EB06 |
Domain d1smva_: 1smv A: [23288] complexed with ca |
PDB Entry: 1smv (more details), 3 Å
SCOPe Domain Sequences for d1smva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smva_ b.121.4.7 (A:) Sobemovirus coat protein {SMV (Sesbania mosaic virus) [TaxId: 12558]} gaitvlhceltaeigvtdsivvsselvmpytvgtwlrgvadnwskyswlsvrytyipscp sstagsihmgfqydmadtvpvsvnklsnlrgyvsgqvwsgsaglcfinnsrcsdtstais ttldvselgkkwypyktsadyatavgvdvniatdlvparlvialldgssstavaagriyd tytiqmieptasalnl
Timeline for d1smva_: