SCOPe 2.05: Domain d1smva_: 1smv A:

Lineage for d1smva_ (1smv A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)

6. Protein Sobemovirus coat protein [88644] (4 species)

7. Species SMV (Sesbania mosaic virus) [TaxId:12558] [49624] (5 PDB entries)
   Uniprot Q9EB06

8. Domain d1smva_: 1smv A: [23288]
   complexed with ca

Details for d1smva_

PDB Entry: 1smv, 3 Å

PDB Description: primary structure of sesbania mosaic virus coat protein: its implications to the assembly and architecture of the virus

PDB Compounds: (A:) sesbania mosaic virus coat protein

SCOPe Domain Sequences for d1smva_:

Sequence; same for both SEQRES and ATOM records:

>d1smva_ b.121.4.7 (A:) Sobemovirus coat protein {SMV (Sesbania mosaic virus) [TaxId: 12558]}
gaitvlhceltaeigvtdsivvsselvmpytvgtwlrgvadnwskyswlsvrytyipscp
sstagsihmgfqydmadtvpvsvnklsnlrgyvsgqvwsgsaglcfinnsrcsdtstais
ttldvselgkkwypyktsadyatavgvdvniatdlvparlvialldgssstavaagriyd
tytiqmieptasalnl

Timeline for d1smva_:

• d1smva_ first appeared (with stable ids) in SCOP 1.55
  
• d1smva_ appears in SCOPe 2.04
  
• d1smva_ appears in SCOPe 2.06
  
• d1smva_ appears in the current release, SCOPe 2.08