SCOPe 2.06: Domain d3m3qa1: 3m3q A:1-158

Lineage for d3m3qa1 (3m3q A:1-158)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)

8. Domain d3m3qa1: 3m3q A:1-158 [232877]
   Other proteins in same PDB: d3m3qa2, d3m3qb2
   automated match to d1ww4a_

Details for d3m3qa1

PDB Entry: 3m3q, 2.2 Å

PDB Description: crystal structure of agrocybe aegerita lectin aal complexed with ganglosides gm1 pentasaccharide

PDB Compounds: (A:) Anti-tumor lectin

SCOPe Domain Sequences for d3m3qa1:

Sequence; same for both SEQRES and ATOM records:

>d3m3qa1 b.29.1.0 (A:1-158) automated matches {Agrocybe aegerita [TaxId: 5400]}
qgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllhi
afrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinektv
iqytkqisgltsslsynateetsifstvveavtytgla

Timeline for d3m3qa1:

• d3m3qa1 first appeared in SCOPe 2.03, called d3m3qa_
  
• d3m3qa1 was called d3m3qa_ in SCOPe 2.05
  
• d3m3qa1 appears in SCOPe 2.07
  
• d3m3qa1 appears in the current release, SCOPe 2.08