Lineage for d3m3qa1 (3m3q A:1-158)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780627Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)
  8. 2780646Domain d3m3qa1: 3m3q A:1-158 [232877]
    Other proteins in same PDB: d3m3qa2, d3m3qb2
    automated match to d1ww4a_

Details for d3m3qa1

PDB Entry: 3m3q (more details), 2.2 Å

PDB Description: crystal structure of agrocybe aegerita lectin aal complexed with ganglosides gm1 pentasaccharide
PDB Compounds: (A:) Anti-tumor lectin

SCOPe Domain Sequences for d3m3qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3qa1 b.29.1.0 (A:1-158) automated matches {Agrocybe aegerita [TaxId: 5400]}
qgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllhi
afrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinektv
iqytkqisgltsslsynateetsifstvveavtytgla

SCOPe Domain Coordinates for d3m3qa1:

Click to download the PDB-style file with coordinates for d3m3qa1.
(The format of our PDB-style files is described here.)

Timeline for d3m3qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3m3qa2