SCOPe 2.03: Domain d3m3ed_: 3m3e D:

Lineage for d3m3ed_ (3m3e D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (23 species)
   not a true protein

7. Species Agrocybe aegerita [TaxId:5400] [231694] (14 PDB entries)

8. Domain d3m3ed_: 3m3e D: [232875]
   automated match to d1ww4a_
   complexed with npo; mutant

Details for d3m3ed_

PDB Entry: 3m3e, 2.1 Å

PDB Description: crystal structure of agrocybe aegerita lectin aal mutant e66a complexed with p-nitrophenyl thomsen-friedenreich disaccharide

PDB Compounds: (D:) Anti-tumor lectin

SCOPe Domain Sequences for d3m3ed_:

Sequence; same for both SEQRES and ATOM records:

>d3m3ed_ b.29.1.0 (D:) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
iafrlqanviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytglal

Timeline for d3m3ed_:

• d3m3ed_ is new in SCOPe 2.03-stable
  
• d3m3ed_ appears in SCOPe 2.04
  
• d3m3ed_ appears in the current release, SCOPe 2.08, called d3m3ed1