Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries) |
Domain d3m3ed1: 3m3e D:1-158 [232875] Other proteins in same PDB: d3m3ea2, d3m3eb2, d3m3ec2, d3m3ec3, d3m3ed2, d3m3ed3 automated match to d1ww4a_ complexed with npo; mutant |
PDB Entry: 3m3e (more details), 2.1 Å
SCOPe Domain Sequences for d3m3ed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m3ed1 b.29.1.0 (D:1-158) automated matches {Agrocybe aegerita [TaxId: 5400]} qgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllhi afrlqanviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinektv iqytkqisgltsslsynateetsifstvveavtytgla
Timeline for d3m3ed1: