Lineage for d3m3ca_ (3m3c A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308833Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1308834Protein automated matches [190437] (23 species)
    not a true protein
  7. 1308835Species Agrocybe aegerita [TaxId:5400] [231694] (14 PDB entries)
  8. 1308842Domain d3m3ca_: 3m3c A: [232870]
    automated match to d1ww4a_
    complexed with npo, so4

Details for d3m3ca_

PDB Entry: 3m3c (more details), 2 Å

PDB Description: crystal structure of agrocybe aegerita lectin aal complexed with p- nitrophenyl tf disaccharide
PDB Compounds: (A:) Anti-tumor lectin

SCOPe Domain Sequences for d3m3ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3ca_ b.29.1.0 (A:) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytgla

SCOPe Domain Coordinates for d3m3ca_:

Click to download the PDB-style file with coordinates for d3m3ca_.
(The format of our PDB-style files is described here.)

Timeline for d3m3ca_: