SCOPe 2.06: Domain d3lxjd1: 3lxj D:952-1084

Lineage for d3lxjd1 (3lxj D:952-1084)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)

8. Domain d3lxjd1: 3lxj D:952-1084 [232861]
   Other proteins in same PDB: d3lxja2, d3lxjb2, d3lxjc2, d3lxjd2
   automated match to d3daia_
   complexed with ipa

Details for d3lxjd1

PDB Entry: 3lxj, 2.33 Å

PDB Description: crystal structure of the bromodomain of human aaa domain containing 2b (atad2b)

PDB Compounds: (D:) ATPase family AAA domain-containing protein 2B

SCOPe Domain Sequences for d3lxjd1:

Sequence; same for both SEQRES and ATOM records:

>d3lxjd1 a.29.2.0 (D:952-1084) automated matches {Human (Homo sapiens) [TaxId: 9606]}
medqeentlrelrlflrdvtkrlatdkrfnifskpvdieevsdylevikepmdlstvitk
idkhnyltakdflkdidlicsnaleynpdkdpgdkiirhractlkdtahaiiaaeldpef
nklceeikearik

Timeline for d3lxjd1:

• d3lxjd1 first appeared in SCOPe 2.03, called d3lxjd_
  
• d3lxjd1 was called d3lxjd_ in SCOPe 2.05
  
• d3lxjd1 appears in SCOPe 2.07
  
• d3lxjd1 appears in the current release, SCOPe 2.08