![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.7: Satellite viruses [88650] (1 family) ![]() |
![]() | Family b.121.7.1: Satellite viruses [88651] (3 proteins) |
![]() | Protein STNV coat protein [49621] (1 species) |
![]() | Species Satellite tobacco necrosis virus [TaxId:12881] [49622] (8 PDB entries) |
![]() | Domain d1a34a_: 1a34 A: [23286] protein/RNA complex; complexed with so4, u |
PDB Entry: 1a34 (more details), 1.81 Å
SCOPe Domain Sequences for d1a34a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a34a_ b.121.7.1 (A:) STNV coat protein {Satellite tobacco necrosis virus [TaxId: 12881]} tgdnsnvvtmiragsypkvnptptwvraipfevsvqsgiafkvpvgslfsanfrtdsfts vtvmsvrawtqltppvneysfvrlkplfktgdsteefegrasnintrasvgyriptnlrq ntvaadnvcevrsncrqvalvisccfn
Timeline for d1a34a_: