Lineage for d3lxjc1 (3lxj C:952-1085)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2708230Domain d3lxjc1: 3lxj C:952-1085 [232858]
    Other proteins in same PDB: d3lxja2, d3lxjb2, d3lxjc2, d3lxjd2
    automated match to d3daia_
    complexed with ipa

Details for d3lxjc1

PDB Entry: 3lxj (more details), 2.33 Å

PDB Description: crystal structure of the bromodomain of human aaa domain containing 2b (atad2b)
PDB Compounds: (C:) ATPase family AAA domain-containing protein 2B

SCOPe Domain Sequences for d3lxjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lxjc1 a.29.2.0 (C:952-1085) automated matches {Human (Homo sapiens) [TaxId: 9606]}
medqeentlrelrlflrdvtkrlatdkrfnifskpvdieevsdylevikepmdlstvitk
idkhnyltakdflkdidlicsnaleynpdkdpgdkiirhractlkdtahaiiaaeldpef
nklceeikearikr

SCOPe Domain Coordinates for d3lxjc1:

Click to download the PDB-style file with coordinates for d3lxjc1.
(The format of our PDB-style files is described here.)

Timeline for d3lxjc1: