Lineage for d3lx9a2 (3lx9 A:324-422)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328233Protein Melibiase [75020] (4 species)
  7. 1328237Species Human (Homo sapiens) [TaxId:9606] [101919] (11 PDB entries)
    alpha-galactosidase A
  8. 1328240Domain d3lx9a2: 3lx9 A:324-422 [232856]
    Other proteins in same PDB: d3lx9a1, d3lx9b1
    automated match to d1r46a1
    complexed with a2g, nag

Details for d3lx9a2

PDB Entry: 3lx9 (more details), 2.04 Å

PDB Description: interconversion of human lysosomal enzyme specificities
PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d3lx9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lx9a2 b.71.1.1 (A:324-422) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmq

SCOPe Domain Coordinates for d3lx9a2:

Click to download the PDB-style file with coordinates for d3lx9a2.
(The format of our PDB-style files is described here.)

Timeline for d3lx9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lx9a1