Class g: Small proteins [56992] (90 folds) |
Fold g.9: Defensin-like [57391] (1 superfamily) Disulfide-rich fold, nearly all-beta |
Superfamily g.9.1: Defensin-like [57392] (3 families) |
Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (1 protein) |
Protein Carboxypeptidase inhibitor [161136] (1 species) consists of two structurally similar to beta-defensin domains |
Species Tick (Rhipicephalus bursa) [TaxId:67831] [161137] (5 PDB entries) Uniprot Q5EPH2 23-59! Uniprot Q5EPH2 60-96 |
Domain d3lmsb1: 3lms B:1-37 [232847] Other proteins in same PDB: d3lmsa_ automated match to d3d4ub1 complexed with ca, cl, gly, gol, k, zn |
PDB Entry: 3lms (more details), 2.5 Å
SCOPe Domain Sequences for d3lmsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lmsb1 g.9.1.3 (B:1-37) Carboxypeptidase inhibitor {Tick (Rhipicephalus bursa) [TaxId: 67831]} necvskgfgclpqsdcpqearlsyggcstvccdlskl
Timeline for d3lmsb1: