Lineage for d3lmsb1 (3lms B:1-37)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584262Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 2584263Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 2584407Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (2 protein domains)
  6. 2584408Protein Carboxypeptidase inhibitor [161136] (1 species)
    consists of two structurally similar to beta-defensin domains
  7. 2584409Species Tick (Rhipicephalus bursa) [TaxId:67831] [161137] (4 PDB entries)
    Uniprot Q5EPH2 23-59! Uniprot Q5EPH2 60-96
  8. 2584416Domain d3lmsb1: 3lms B:1-37 [232847]
    Other proteins in same PDB: d3lmsa_
    automated match to d3d4ub1
    complexed with ca, cl, gly, gol, k, zn

Details for d3lmsb1

PDB Entry: 3lms (more details), 2.5 Å

PDB Description: structure of human activated thrombin-activatable fibrinolysis inhibitor, tafia, in complex with tick-derived funnelin inhibitor, tci.
PDB Compounds: (B:) carboxypeptidase inhibitor

SCOPe Domain Sequences for d3lmsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lmsb1 g.9.1.3 (B:1-37) Carboxypeptidase inhibitor {Tick (Rhipicephalus bursa) [TaxId: 67831]}
necvskgfgclpqsdcpqearlsyggcstvccdlskl

SCOPe Domain Coordinates for d3lmsb1:

Click to download the PDB-style file with coordinates for d3lmsb1.
(The format of our PDB-style files is described here.)

Timeline for d3lmsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lmsb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3lmsa_