Lineage for d3lida2 (3lid A:207-311)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970927Superfamily d.110.6: Sensory domain-like [103190] (5 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2970952Family d.110.6.2: YkuI C-terminal domain-like [143732] (3 proteins)
    PfamB PB021678
  6. 2970953Protein GGDEF family protein VP0354, C-terminal domain [419049] (1 species)
    protein is N-terminal region; consists of two sensory domain-like domains; there is a canonical sensory (PAS) domain in the middle region
  7. 2970954Species Vibrio parahaemolyticus [TaxId:670] [419536] (3 PDB entries)
    Uniprot Q87SR8 207-299
  8. 2970957Domain d3lida2: 3lid A:207-311 [232845]
    Other proteins in same PDB: d3lida1, d3lidb1
    automated match to d2p7jb1
    complexed with cl, edo, po4

    missing some secondary structures that made up less than one-third of the common domain

Details for d3lida2

PDB Entry: 3lid (more details), 1.76 Å

PDB Description: crystal structure of the extracellular domain of the putative histidine kinase vphk1s-z8
PDB Compounds: (A:) Putative sensory box/GGDEF family protein

SCOPe Domain Sequences for d3lida2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lida2 d.110.6.2 (A:207-311) GGDEF family protein VP0354, C-terminal domain {Vibrio parahaemolyticus [TaxId: 670]}
nyspvrdfhielvkhkgfyiaspdesrlygdiipersqfnfsnmypdiwprvvseqagys
ysgehliafssikfvsneplhliidlsneqlskratrdindliqe

SCOPe Domain Coordinates for d3lida2:

Click to download the PDB-style file with coordinates for d3lida2.
(The format of our PDB-style files is described here.)

Timeline for d3lida2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lida1