![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
![]() | Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) ![]() |
![]() | Family b.10.1.2: Plant virus proteins [49616] (15 proteins) |
![]() | Protein SPMV coat protein [49617] (1 species) |
![]() | Species Satellite panicum mosaic virus [TaxId:154834] [49618] (1 PDB entry) |
![]() | Domain d1stmd_: 1stm D: [23284] |
PDB Entry: 1stm (more details), 1.9 Å
SCOP Domain Sequences for d1stmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1stmd_ b.10.1.2 (D:) SPMV coat protein {Satellite panicum mosaic virus} aaatslvydtcyvtlterattsfqrqsfptlkgmgdrafqvvaftiqgvsaaplmynarl ynpgdtdsvhatgvqlmgtvprtvrltprvgqnnwffgnteeaetilaidglvstkgana psntvivtgcfrlapselqss
Timeline for d1stmd_:
![]() Domains from other chains: (mouse over for more information) d1stma_, d1stmb_, d1stmc_, d1stme_ |