SCOPe 2.03: Domain d3lgya_: 3lgy A:

Lineage for d3lgya_ (3lgy A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein automated matches [190306] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [225952] (10 PDB entries)

8. Domain d3lgya_: 3lgy A: [232839]
   automated match to d3lgib_
   complexed with cl, mg; mutant

Details for d3lgya_

PDB Entry: 3lgy, 2.7 Å

PDB Description: r178a mutant of the degs-deltapdz protease

PDB Compounds: (A:) Protease degS

SCOPe Domain Sequences for d3lgya_:

Sequence, based on SEQRES records:

>d3lgya_ b.47.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
stdetpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvi
ndadqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlai
gnpynlgqtitqgiisatgaiglnptgrqnflqtdasinhgnsggalvnslgelmgintl
sfdksndgetpegigfaipfqlatkimdklird

Sequence, based on observed residues (ATOM records):

>d3lgya_ b.47.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
stdetpasynlavrraapavvnvynrleirtlgsgvimdqrgyiitnkhvindadqiiva
lqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpgqtitq
giisatflqtdasinhgnsggalvnslgelmgintlpegigfaipfqlatkimdklird

Timeline for d3lgya_:

• d3lgya_ is new in SCOPe 2.03-stable
  
• d3lgya_ appears in SCOPe 2.04
  
• d3lgya_ appears in the current release, SCOPe 2.08