Lineage for d3lgta_ (3lgt A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055631Family b.47.1.1: Prokaryotic proteases [50495] (16 protein domains)
  6. 2055830Protein automated matches [190306] (7 species)
    not a true protein
  7. 2055831Species Escherichia coli K-12 [TaxId:83333] [225952] (8 PDB entries)
  8. 2055847Domain d3lgta_: 3lgt A: [232835]
    automated match to d3lgib_
    mutant

Details for d3lgta_

PDB Entry: 3lgt (more details), 2.68 Å

PDB Description: y162a/h198p double mutant of degs-deltapdz protease
PDB Compounds: (A:) Protease degS

SCOPe Domain Sequences for d3lgta_:

Sequence, based on SEQRES records: (download)

>d3lgta_ b.47.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
stdetpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvi
ndadqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlai
gnpanlgqtitqgiisatgriglnptgrqnflqtdasinpgnsggalvnslgelmgintl
sfdksndgetpegigfaipfqlatkimdklirdgr

Sequence, based on observed residues (ATOM records): (download)

>d3lgta_ b.47.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
stdetpasynlavrraapavvnvynrirtlgsgvimdqrgyiitnkhvindadqiivalq
dgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpagqtitqg
iisatgnflqtdasinpgnsggalvnslgelmgintlsgigfaipfqlatkimdklirdg
r

SCOPe Domain Coordinates for d3lgta_:

Click to download the PDB-style file with coordinates for d3lgta_.
(The format of our PDB-style files is described here.)

Timeline for d3lgta_: