Lineage for d3lflc2 (3lfl C:103-228)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 2322207Protein Class omega GST [81352] (1 species)
  7. 2322208Species Human (Homo sapiens) [TaxId:9606] [47632] (9 PDB entries)
  8. 2322219Domain d3lflc2: 3lfl C:103-228 [232832]
    Other proteins in same PDB: d3lfla1, d3lflb1, d3lflc1
    automated match to d1eema1
    complexed with dtt, gsh

Details for d3lflc2

PDB Entry: 3lfl (more details), 2.1 Å

PDB Description: crystal structure of human glutathione transferase omega 1, delta 155
PDB Compounds: (C:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d3lflc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lflc2 a.45.1.1 (C:103-228) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftklevltnkktt
ffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdwq
gflely

SCOPe Domain Coordinates for d3lflc2:

Click to download the PDB-style file with coordinates for d3lflc2.
(The format of our PDB-style files is described here.)

Timeline for d3lflc2: