SCOPe 2.04: Domain d3lflc1: 3lfl C:5-102

Lineage for d3lflc1 (3lfl C:5-102)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein automated matches [227019] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232826] (4 PDB entries)

8. Domain d3lflc1: 3lfl C:5-102 [232831]
   Other proteins in same PDB: d3lfla2, d3lflb2, d3lflc2
   automated match to d1eema2
   complexed with dtt, gsh

Details for d3lflc1

PDB Entry: 3lfl, 2.1 Å

PDB Description: crystal structure of human glutathione transferase omega 1, delta 155

PDB Compounds: (C:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d3lflc1:

Sequence; same for both SEQRES and ATOM records:

>d3lflc1 c.47.1.5 (C:5-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewff
kknpfglvpvlensqgqliyesaitceyldeaypgkkl

Timeline for d3lflc1:

• d3lflc1 first appeared in SCOPe 2.03
  
• d3lflc1 appears in SCOPe 2.05
  
• d3lflc1 appears in the current release, SCOPe 2.08