Lineage for d3lflc1 (3lfl C:5-102)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2455762Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 protein domains)
  6. 2456073Protein Class omega GST [81363] (1 species)
  7. 2456074Species Human (Homo sapiens) [TaxId:9606] [52877] (9 PDB entries)
  8. 2456085Domain d3lflc1: 3lfl C:5-102 [232831]
    Other proteins in same PDB: d3lfla2, d3lflb2, d3lflc2
    automated match to d1eema2
    complexed with dtt, gsh

Details for d3lflc1

PDB Entry: 3lfl (more details), 2.1 Å

PDB Description: crystal structure of human glutathione transferase omega 1, delta 155
PDB Compounds: (C:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d3lflc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lflc1 c.47.1.5 (C:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
sarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewff
kknpfglvpvlensqgqliyesaitceyldeaypgkkl

SCOPe Domain Coordinates for d3lflc1:

Click to download the PDB-style file with coordinates for d3lflc1.
(The format of our PDB-style files is described here.)

Timeline for d3lflc1: