| Class b: All beta proteins [48724] (110 folds) |
| Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) ![]() |
| Family b.10.1.2: Plant virus proteins [49616] (15 proteins) |
| Protein SPMV coat protein [49617] (1 species) |
| Species Satellite panicum mosaic virus [TaxId:154834] [49618] (1 PDB entry) |
| Domain d1stmc_: 1stm C: [23283] |
PDB Entry: 1stm (more details), 1.9 Å
SCOP Domain Sequences for d1stmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1stmc_ b.10.1.2 (C:) SPMV coat protein {Satellite panicum mosaic virus}
aaatslvydtcyvtlterattsfqrqsfptlkgmgdrafqvvaftiqgvsaaplmynarl
ynpgdtdsvhatgvqlmgtvprtvrltprvgqnnwffgnteeaetilaidglvstkgana
psntvivtgcfrlapselqss
Timeline for d1stmc_:
View in 3DDomains from other chains: (mouse over for more information) d1stma_, d1stmb_, d1stmd_, d1stme_ |