SCOPe 2.08: Domain d3lflb2: 3lfl B:103-230

Lineage for d3lflb2 (3lfl B:103-230)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class omega GST [81352] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47632] (17 PDB entries)

8. Domain d3lflb2: 3lfl B:103-230 [232829]
   Other proteins in same PDB: d3lfla1, d3lflb1, d3lflc1
   automated match to d1eema1
   complexed with dtt, gsh

Details for d3lflb2

PDB Entry: 3lfl, 2.1 Å

PDB Description: crystal structure of human glutathione transferase omega 1, delta 155

PDB Compounds: (B:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d3lflb2:

Sequence; same for both SEQRES and ATOM records:

>d3lflb2 a.45.1.1 (B:103-230) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftklevltnkktt
ffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdwq
gflelylq

Timeline for d3lflb2:

• d3lflb2 first appeared in SCOPe 2.03
  
• d3lflb2 appears in SCOPe 2.07