Lineage for d3ldaa2 (3lda A:145-396)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112413Protein DNA repair protein Rad51, catalytic domain [82412] (7 species)
  7. 2112414Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110554] (2 PDB entries)
    Uniprot P25454 81-395
  8. 2112415Domain d3ldaa2: 3lda A:145-396 [232825]
    Other proteins in same PDB: d3ldaa1
    automated match to d1szpa2
    complexed with cl; mutant

Details for d3ldaa2

PDB Entry: 3lda (more details), 2.5 Å

PDB Description: Yeast Rad51 H352Y Filament Interface Mutant
PDB Compounds: (A:) DNA repair protein rad51

SCOPe Domain Sequences for d3ldaa2:

Sequence, based on SEQRES records: (download)

>d3ldaa2 c.37.1.11 (A:145-396) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtlavtcqi
pldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhqlrllda
aaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgvavvvt
nqvvaqvdggmafnpdpkkpiggnimayssttrlgfkkgkgcqrlckvvdspclpeaecv
faiyedgvgdpr

Sequence, based on observed residues (ATOM records): (download)

>d3ldaa2 c.37.1.11 (A:145-396) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtlavtcqi
pldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhqlrllda
aaqmmsesrfslivvdsvmalyrgelsarqmhlakfmralqrladqfgvavvvtnqvnim
ayssttrlgfkkgkgcqrlckvvdspclpeaecvfaiyedgvgdpr

SCOPe Domain Coordinates for d3ldaa2:

Click to download the PDB-style file with coordinates for d3ldaa2.
(The format of our PDB-style files is described here.)

Timeline for d3ldaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ldaa1