Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.1: DNA polymerase I [56673] (5 proteins) |
Protein Family B DNA polymerase [56680] (7 species) |
Species Bacteriophage RB69 [TaxId:12353] [56681] (93 PDB entries) |
Domain d3l8bb2: 3l8b B:376-903 [232823] Other proteins in same PDB: d3l8ba1, d3l8bb1 automated match to d1ih7a2 protein/DNA complex; complexed with so4 |
PDB Entry: 3l8b (more details), 2.15 Å
SCOPe Domain Sequences for d3l8bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l8bb2 e.8.1.1 (B:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]} qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf
Timeline for d3l8bb2: