Lineage for d3l7zg2 (3l7z G:188-270)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426090Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1426091Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1426273Family d.101.1.0: automated matches [227218] (1 protein)
    not a true family
  6. 1426274Protein automated matches [226956] (4 species)
    not a true protein
  7. 1426294Species Sulfolobus solfataricus [TaxId:2287] [232814] (1 PDB entry)
  8. 1426297Domain d3l7zg2: 3l7z G:188-270 [232819]
    Other proteins in same PDB: d3l7za1, d3l7zd1, d3l7zg1
    automated match to d2je6a2
    protein/RNA complex; complexed with so4

Details for d3l7zg2

PDB Entry: 3l7z (more details), 2.41 Å

PDB Description: crystal structure of the s. solfataricus archaeal exosome
PDB Compounds: (G:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d3l7zg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l7zg2 d.101.1.0 (G:188-270) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlg

SCOPe Domain Coordinates for d3l7zg2:

Click to download the PDB-style file with coordinates for d3l7zg2.
(The format of our PDB-style files is described here.)

Timeline for d3l7zg2: