Lineage for d3l7zg1 (3l7z G:1-187)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537487Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 2537630Protein automated matches [232811] (2 species)
    not a true protein
  7. 2537638Species Sulfolobus solfataricus [TaxId:2287] [232812] (4 PDB entries)
  8. 2537665Domain d3l7zg1: 3l7z G:1-187 [232818]
    Other proteins in same PDB: d3l7za2, d3l7zc1, d3l7zc2, d3l7zc3, d3l7zd2, d3l7zg2, d3l7zi1, d3l7zi2, d3l7zi3
    automated match to d2je6a1
    protein/RNA complex; complexed with so4

Details for d3l7zg1

PDB Entry: 3l7z (more details), 2.41 Å

PDB Description: crystal structure of the s. solfataricus archaeal exosome
PDB Compounds: (G:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d3l7zg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l7zg1 d.14.1.4 (G:1-187) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayttfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
nevvgkl

SCOPe Domain Coordinates for d3l7zg1:

Click to download the PDB-style file with coordinates for d3l7zg1.
(The format of our PDB-style files is described here.)

Timeline for d3l7zg1: